TGF beta Receptor II/TGFBR2 Antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: TGF beta Receptor II/TGFBR2 Antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: BYT-ORB334561
• Hersteller Artikelnummer: orb334561
• Alternativnummer: BYT-ORB334561-10,BYT-ORB334561-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: TGF-beta receptor type-2,TGFR-2,2.7.11.30,TGF-beta type II receptor,Transforming growth factor-beta receptor type II,TGF-beta receptor type II,TbetaR-II,TGFBR2,

Produktbeschreibung

TGF beta Receptor II/TGFBR2 Antibody

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molekulargewicht: 64568 MW
• UniProt: P37173
• Formulierung: Lyophilized

Anwendungsbeschreibung

• Application Verdünnung: Western blot, 0.1-0.5µg/ml, Human
• Anwendungsbeschreibung: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.