TGF beta Receptor II/TGFBR2 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: TGF beta Receptor II/TGFBR2 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB334561
• Supplier Catalog Number: orb334561
• Alternative Catalog Number: BYT-ORB334561-10,BYT-ORB334561-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
• Conjugation: Unconjugated
• Alternative Names: TGF-beta receptor type-2,TGFR-2,2.7.11.30,TGF-beta type II receptor,Transforming growth factor-beta receptor type II,TGF-beta receptor type II,TbetaR-II,TGFBR2,

Product Description

TGF beta Receptor II/TGFBR2 Antibody

Product Properties

• Clonality: Polyclonal
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molecular Weight: 64568 MW
• UniProt: P37173
• Form: Lyophilized

Application Notes

• Application Dilute: Western blot, 0.1-0.5µg/ml, Human
• Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.