Human MUC2 protein

Artikelnummer: BYT-ORB358107
Artikelname: Human MUC2 protein
Artikelnummer: BYT-ORB358107
Hersteller Artikelnummer: orb358107
Alternativnummer: BYT-ORB358107-1,BYT-ORB358107-100,BYT-ORB358107-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Intestinal mucin 2 protein, Intestinal mucin-2 protein, MLP protein, MUC 2 protein, MUC-2 protein, Muc2 protein, MUC2_HUMAN protein, Mucin 2 protein, Mucin 2 intestinal protein, Mucin 2 intestinal/tracheal protein, Mucin 2 oligomeric mucus/gel forming protein, Mucin 2 precursor protein, Mucin 2 tracheal protein, Mucin like protein protein, Mucin-2 protein, Mucin2 protein, SMUC protein
This Human MUC2 protein spans the amino acid sequence from region 36-240aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.8 kDa
UniProt: Q02817
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of VWFD 1 of His-SUMO-tag and expression region is 36-240aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MUC2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MUC2.