Human MUC2 protein

Product Overview

• Article Name: Human MUC2 protein
• Biozol Catalog Number: BYT-ORB358107
• Supplier Catalog Number: orb358107
• Alternative Catalog Number: BYT-ORB358107-1,BYT-ORB358107-100,BYT-ORB358107-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Intestinal mucin 2 protein, Intestinal mucin-2 protein, MLP protein, MUC 2 protein, MUC-2 protein, Muc2 protein, MUC2_HUMAN protein, Mucin 2 protein, Mucin 2 intestinal protein, Mucin 2 intestinal/tracheal protein, Mucin 2 oligomeric mucus/gel forming protein, Mucin 2 precursor protein, Mucin 2 tracheal protein, Mucin like protein protein, Mucin-2 protein, Mucin2 protein, SMUC protein

Product Description

This Human MUC2 protein spans the amino acid sequence from region 36-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 38.8 kDa
• UniProt: Q02817
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of VWFD 1 of His-SUMO-tag and expression region is 36-240aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MUC2.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MUC2.