Mouse Ccr5 protein

Produktübersicht

• Artikelname: Mouse Ccr5 protein
• Artikelnummer: BYT-ORB358231
• Hersteller Artikelnummer: orb358231
• Alternativnummer: BYT-ORB358231-1,BYT-ORB358231-100,BYT-ORB358231-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: MIP-1 alpha receptor CD_antigen, CD195

Produktbeschreibung

This Mouse Ccr5 protein spans the amino acid sequence from region 263-354aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 12.6 kDa
• UniProt: P51682
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ccr5.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ccr5.

The purity of Ccr5 was greater than 95% as determined by SEC-HPLC