Mouse Ccr5 protein

Product Overview

• Article Name: Mouse Ccr5 protein
• Biozol Catalog Number: BYT-ORB358231
• Supplier Catalog Number: orb358231
• Alternative Catalog Number: BYT-ORB358231-1,BYT-ORB358231-100,BYT-ORB358231-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: MIP-1 alpha receptor CD_antigen, CD195

Product Description

This Mouse Ccr5 protein spans the amino acid sequence from region 263-354aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 12.6 kDa
• UniProt: P51682
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ccr5.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ccr5.

The purity of Ccr5 was greater than 95% as determined by SEC-HPLC