Human CTPS1 protein

Artikelnummer: BYT-ORB358331
Artikelname: Human CTPS1 protein
Artikelnummer: BYT-ORB358331
Hersteller Artikelnummer: orb358331
Alternativnummer: BYT-ORB358331-1,BYT-ORB358331-100,BYT-ORB358331-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CTP synthetase 1 UTP--ammonia ligase 1
This Human CTPS1 protein spans the amino acid sequence from region 1-591aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 68.7 kDa
UniProt: P17812
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
SDS-PAGE analysis of Human CTPS1 protein.