Human CTPS1 protein

Product Overview

• Article Name: Human CTPS1 protein
• Biozol Catalog Number: BYT-ORB358331
• Supplier Catalog Number: orb358331
• Alternative Catalog Number: BYT-ORB358331-1,BYT-ORB358331-100,BYT-ORB358331-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CTP synthetase 1 UTP--ammonia ligase 1

Product Description

This Human CTPS1 protein spans the amino acid sequence from region 1-591aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 68.7 kDa
• UniProt: P17812
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPL

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

SDS-PAGE analysis of Human CTPS1 protein.