Insect DERF2 protein

Produktübersicht

• Artikelname: Insect DERF2 protein
• Artikelnummer: BYT-ORB358487
• Hersteller Artikelnummer: orb358487
• Alternativnummer: BYT-ORB358487-1,BYT-ORB358487-100,BYT-ORB358487-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Allergen Der f II Allergen, Der f 2

Produktbeschreibung

This Insect DERF2 protein spans the amino acid sequence from region 18-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 16.1 kDa
• UniProt: Q00855
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Dermatophagoides farinae (American house dust mite)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Dermatophagoides farinae (American house dust mite). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Dermatophagoides farinae (American house dust mite) DERF2.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Dermatophagoides farinae (American house dust mite) DERF2.