Insect DERF2 protein

Product Overview

• Article Name: Insect DERF2 protein
• Biozol Catalog Number: BYT-ORB358487
• Supplier Catalog Number: orb358487
• Alternative Catalog Number: BYT-ORB358487-1,BYT-ORB358487-100,BYT-ORB358487-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Allergen Der f II Allergen, Der f 2

Product Description

This Insect DERF2 protein spans the amino acid sequence from region 18-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 16.1 kDa
• UniProt: Q00855
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Dermatophagoides farinae (American house dust mite)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Application Notes

• Application Notes: Biological Origin: Dermatophagoides farinae (American house dust mite). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Dermatophagoides farinae (American house dust mite) DERF2.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Dermatophagoides farinae (American house dust mite) DERF2.