Mouse Mup6 protein

Produktübersicht

• Artikelname: Mouse Mup6 protein
• Artikelnummer: BYT-ORB358613
• Hersteller Artikelnummer: orb358613
• Alternativnummer: BYT-ORB358613-1, BYT-ORB358613-100, BYT-ORB358613-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Alpha-2U-globulin Group 1, BS6 Allergen, Mus m 1

Produktbeschreibung

This Mouse Mup6 protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 34.7 kDa
• UniProt: P02762
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein