Mouse Mup6 protein

Catalog Number: BYT-ORB358613
Article Name: Mouse Mup6 protein
Biozol Catalog Number: BYT-ORB358613
Supplier Catalog Number: orb358613
Alternative Catalog Number: BYT-ORB358613-1, BYT-ORB358613-100, BYT-ORB358613-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Alpha-2U-globulin Group 1, BS6 Allergen, Mus m 1
This Mouse Mup6 protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 34.7 kDa
UniProt: P02762
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein