Human C6orf144 protein

Produktübersicht

• Artikelname: Human C6orf144 protein
• Artikelnummer: BYT-ORB358708
• Hersteller Artikelnummer: orb358708
• Alternativnummer: BYT-ORB358708-1,BYT-ORB358708-100,BYT-ORB358708-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: bA360D14.1, C6orf144, GDNF family receptor alpha-like, Gfral, GFRAL_HUMAN, GRAL, IVFI9356, UNQ9356, UNQ9356/PRO34128

Produktbeschreibung

This Human C6orf144 protein spans the amino acid sequence from region 19-351aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 53.8 kDa
• UniProt: Q6UXV0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.