Human C6orf144 protein

Catalog Number: BYT-ORB358708
Article Name: Human C6orf144 protein
Biozol Catalog Number: BYT-ORB358708
Supplier Catalog Number: orb358708
Alternative Catalog Number: BYT-ORB358708-1,BYT-ORB358708-100,BYT-ORB358708-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: bA360D14.1, C6orf144, GDNF family receptor alpha-like, Gfral, GFRAL_HUMAN, GRAL, IVFI9356, UNQ9356, UNQ9356/PRO34128
This Human C6orf144 protein spans the amino acid sequence from region 19-351aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 53.8 kDa
UniProt: Q6UXV0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSD
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.