E. coli ppx protein
Artikelnummer:
BYT-ORB358809
- Bilder (3)
| Artikelname: | E. coli ppx protein |
| Artikelnummer: | BYT-ORB358809 |
| Hersteller Artikelnummer: | orb358809 |
| Alternativnummer: | BYT-ORB358809-1,BYT-ORB358809-100,BYT-ORB358809-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Metaphosphatase |
| This E. coli ppx protein spans the amino acid sequence from region 2-513aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 74 kDa |
| UniProt: | P0AFL6 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Escherichia coli (strain K12) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | PIHDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCIVGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQGWNVAMGASGTIKAAHEVLMEMGEKDGIITPERLEKLVKEVLRHRNFA |
| Anwendungsbeschreibung: | Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-SUMO-tag protein |



