E. coli ppx protein

Product Overview

• Article Name: E. coli ppx protein
• Biozol Catalog Number: BYT-ORB358809
• Supplier Catalog Number: orb358809
• Alternative Catalog Number: BYT-ORB358809-1,BYT-ORB358809-100,BYT-ORB358809-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Metaphosphatase

Product Description

This E. coli ppx protein spans the amino acid sequence from region 2-513aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 74 kDa
• UniProt: P0AFL6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli (strain K12)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: PIHDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCIVGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQGWNVAMGASGTIKAAHEVLMEMGEKDGIITPERLEKLVKEVLRHRNFA

Application Notes

• Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ppx.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ppx.