Mouse RES protein

Artikelnummer: BYT-ORB382968
Artikelname: Mouse RES protein
Artikelnummer: BYT-ORB382968
Hersteller Artikelnummer: orb382968
Alternativnummer: BYT-ORB382968-1,BYT-ORB382968-100,BYT-ORB382968-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Adipose tissue-specific secretory factor , ADSFAdipose-specific cysteine-rich secreted protein A12-alpha, Cysteine-rich secreted protein FIZZ3
This Mouse RES protein spans the amino acid sequence from region 21-114aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 14.2 kDa
UniProt: Q99P87
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Retn.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Retn.