Mouse RES protein

Product Overview

• Article Name: Mouse RES protein
• Biozol Catalog Number: BYT-ORB382968
• Supplier Catalog Number: orb382968
• Alternative Catalog Number: BYT-ORB382968-1,BYT-ORB382968-100,BYT-ORB382968-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Adipose tissue-specific secretory factor , ADSFAdipose-specific cysteine-rich secreted protein A12-alpha, Cysteine-rich secreted protein FIZZ3

Product Description

This Mouse RES protein spans the amino acid sequence from region 21-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 14.2 kDa
• UniProt: Q99P87
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Retn.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Retn.