Viral K3L protein

Artikelnummer: BYT-ORB383027
Artikelname: Viral K3L protein
Artikelnummer: BYT-ORB383027
Hersteller Artikelnummer: orb383027
Alternativnummer: BYT-ORB383027-1,BYT-ORB383027-100,BYT-ORB383027-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: K3L, Protein K3
This Viral K3L protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.5 kDa
UniProt: P20639
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Vaccinia virus (strain Copenhagen) (VACV)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Anwendungsbeschreibung: Biological Origin: Vaccinia virus (strain Copenhagen) (VACV). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Vaccinia virus (strain Copenhagen) (VACV) K3L.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Vaccinia virus (strain Copenhagen) (VACV) K3L.