Viral K3L protein

Product Overview

• Article Name: Viral K3L protein
• Biozol Catalog Number: BYT-ORB383027
• Supplier Catalog Number: orb383027
• Alternative Catalog Number: BYT-ORB383027-1,BYT-ORB383027-100,BYT-ORB383027-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: K3L, Protein K3

Product Description

This Viral K3L protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 26.5 kDa
• UniProt: P20639
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Vaccinia virus (strain Copenhagen) (VACV)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Application Notes

• Application Notes: Biological Origin: Vaccinia virus (strain Copenhagen) (VACV). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Vaccinia virus (strain Copenhagen) (VACV) K3L.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Vaccinia virus (strain Copenhagen) (VACV) K3L.