Viral VACWR090 protein

Artikelnummer: BYT-ORB383427
Artikelname: Viral VACWR090 protein
Artikelnummer: BYT-ORB383427
Hersteller Artikelnummer: orb383427
Alternativnummer: BYT-ORB383427-20,BYT-ORB383427-100,BYT-ORB383427-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein F4
Recombinant viral VACWR090 protein.
Molekulargewicht: 42.6 kDa
UniProt: P07614
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNH
Anwendungsbeschreibung: Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.