Viral VACWR090 protein

Catalog Number: BYT-ORB383427
Article Name: Viral VACWR090 protein
Biozol Catalog Number: BYT-ORB383427
Supplier Catalog Number: orb383427
Alternative Catalog Number: BYT-ORB383427-20,BYT-ORB383427-100,BYT-ORB383427-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein F4
Recombinant viral VACWR090 protein.
Molecular Weight: 42.6 kDa
UniProt: P07614
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNH
Application Notes: Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length