Mouse PCMP-H63 protein

Produktübersicht

• Artikelname: Mouse PCMP-H63 protein
• Artikelnummer: BYT-ORB383430
• Hersteller Artikelnummer: orb383430
• Alternativnummer: BYT-ORB383430-1,BYT-ORB383430-100,BYT-ORB383430-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: PCMP-H63, At4g32450, F8B4.150, Pentatricopeptide repeat-containing protein At4g32450, mitochondrial

Produktbeschreibung

This Mouse PCMP-H63 protein spans the amino acid sequence from region 111-537aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 53.3 kDa
• UniProt: Q9SUU7
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Arabidopsis thaliana (Mouse-ear cress)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QNWQSSDGCSSYGTTGNGVPQENNTGGNHFQQDHSGHSSLDELDSICREGKVKKAVEIIKSWRNEGYVVDLPRLFWIAQLCGDAQALQEAKVVHEFITSSVGISDISAYNSIIEMYSGCGSVEDALTVFNSMPERNLETWCGVIRCFAKNGQGEDAIDTFSRFKQEGNKPDGEMFKEIFFACGVLGDMNEGLLHFESMYKEYGIIPCMEHYVSLVKMLAEPGYLDEALRFVESMEPNVDLWETLMNLSRVHGDLI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.