Mouse PCMP-H63 protein

Product Overview

• Article Name: Mouse PCMP-H63 protein
• Biozol Catalog Number: BYT-ORB383430
• Supplier Catalog Number: orb383430
• Alternative Catalog Number: BYT-ORB383430-20,BYT-ORB383430-100,BYT-ORB383430-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: PCMP-H63, At4g32450, F8B4.150, Pentatricopeptide repeat-containing protein At4g32450, mitochondrial

Product Description

Recombinant mouse PCMP-H63 protein.

Product Properties

• Molecular Weight: 53.3 kDa
• UniProt: Q9SUU7
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Arabidopsis thaliana (Mouse-ear cress)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QNWQSSDGCSSYGTTGNGVPQENNTGGNHFQQDHSGHSSLDELDSICREGKVKKAVEIIKSWRNEGYVVDLPRLFWIAQLCGDAQALQEAKVVHEFITSSVGISDISAYNSIIEMYSGCGSVEDALTVFNSMPERNLETWCGVIRCFAKNGQGEDAIDTFSRFKQEGNKPDGEMFKEIFFACGVLGDMNEGLLHFESMYKEYGIIPCMEHYVSLVKMLAEPGYLDEALRFVESMEPNVDLWETLMNLSRVHGDLI

Application Notes

• Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.