Mouse Tmprss15 protein

Produktübersicht

• Artikelname: Mouse Tmprss15 protein
• Artikelnummer: BYT-ORB383431
• Hersteller Artikelnummer: orb383431
• Alternativnummer: BYT-ORB383431-20,BYT-ORB383431-100,BYT-ORB383431-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 2 chains, Enteropeptidase non-catalytic heavy chain Enteropeptidase catalytic light chain

Produktbeschreibung

Recombinant mouse Tmprss15 protein.

Produkteigenschaften

• Molekulargewicht: 43 kDa
• UniProt: P97435
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-sumo-tagged Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmprss15.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmprss15.