Mouse Tmprss15 protein

Catalog Number: BYT-ORB383431
Article Name: Mouse Tmprss15 protein
Biozol Catalog Number: BYT-ORB383431
Supplier Catalog Number: orb383431
Alternative Catalog Number: BYT-ORB383431-20,BYT-ORB383431-100,BYT-ORB383431-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 2 chains, Enteropeptidase non-catalytic heavy chain Enteropeptidase catalytic light chain
Recombinant mouse Tmprss15 protein.
Molecular Weight: 43 kDa
UniProt: P97435
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-sumo-tagged Partial