Mouse Tmprss15 protein

Product Overview

• Article Name: Mouse Tmprss15 protein
• Biozol Catalog Number: BYT-ORB383431
• Supplier Catalog Number: orb383431
• Alternative Catalog Number: BYT-ORB383431-1,BYT-ORB383431-100,BYT-ORB383431-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 2 chains, Enteropeptidase non-catalytic heavy chain Enteropeptidase catalytic light chain

Product Description

This Mouse Tmprss15 protein spans the amino acid sequence from region 830-1069aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 43 kDa
• UniProt: P97435
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-sumo-tagged Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmprss15.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmprss15.