Human CXCL10 protein

Artikelnummer: BYT-ORB383438
Artikelname: Human CXCL10 protein
Artikelnummer: BYT-ORB383438
Hersteller Artikelnummer: orb383438
Alternativnummer: BYT-ORB383438-20,BYT-ORB383438-100,BYT-ORB383438-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 10KDA interferon gamma-induced protein Short name, Gamma-IP10 Short name, IP-10 Small-inducible cytokine B10
Recombinant human CXCL10 protein
Molekulargewicht: 12.6 kDa
UniProt: P02778
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length