Human CXCL10 protein

Catalog Number: BYT-ORB383438
Article Name: Human CXCL10 protein
Biozol Catalog Number: BYT-ORB383438
Supplier Catalog Number: orb383438
Alternative Catalog Number: BYT-ORB383438-20,BYT-ORB383438-100,BYT-ORB383438-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 10KDA interferon gamma-induced protein Short name, Gamma-IP10 Short name, IP-10 Small-inducible cytokine B10
Recombinant human CXCL10 protein
Molecular Weight: 12.6 kDa
UniProt: P02778
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length