Human SIGLEC15 protein

Artikelnummer: BYT-ORB383440
Artikelname: Human SIGLEC15 protein
Artikelnummer: BYT-ORB383440
Hersteller Artikelnummer: orb383440
Alternativnummer: BYT-ORB383440-20,BYT-ORB383440-100,BYT-ORB383440-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CD33 antigen-like 3
Recombinant human SIGLEC15 protein
Molekulargewicht: 30.6 kDa
UniProt: Q6ZMC9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged and Flag-tagged Full Length