Human SIGLEC15 protein

Catalog Number: BYT-ORB383440
Article Name: Human SIGLEC15 protein
Biozol Catalog Number: BYT-ORB383440
Supplier Catalog Number: orb383440
Alternative Catalog Number: BYT-ORB383440-20,BYT-ORB383440-100,BYT-ORB383440-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD33 antigen-like 3
Recombinant human SIGLEC15 protein
Molecular Weight: 30.6 kDa
UniProt: Q6ZMC9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged and Flag-tagged Full Length