Rat Amigo3 protein

Artikelnummer: BYT-ORB383441
Artikelname: Rat Amigo3 protein
Artikelnummer: BYT-ORB383441
Hersteller Artikelnummer: orb383441
Alternativnummer: BYT-ORB383441-20,BYT-ORB383441-100,BYT-ORB383441-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: AMIGO-3 Alivin-3
Recombinant rat Amigo3 protein
Molekulargewicht: 44.4 kDa
UniProt: Q80ZD5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCS
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length