Rat Amigo3 protein

Catalog Number: BYT-ORB383441
Article Name: Rat Amigo3 protein
Biozol Catalog Number: BYT-ORB383441
Supplier Catalog Number: orb383441
Alternative Catalog Number: BYT-ORB383441-1,BYT-ORB383441-100,BYT-ORB383441-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: AMIGO-3 Alivin-3
This Rat Amigo3 protein spans the amino acid sequence from region 20-383aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.4 kDa
UniProt: Q80ZD5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCS
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.