A27L protein

Artikelnummer: BYT-ORB383445
Artikelname: A27L protein
Artikelnummer: BYT-ORB383445
Hersteller Artikelnummer: orb383445
Alternativnummer: BYT-ORB383445-20,BYT-ORB383445-100,BYT-ORB383445-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: A27L, A30L14 kDa fusion protein
Recombinant A27L protein
Molekulargewicht: 15.0 kDa
UniProt: P33816
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Smallpox virus
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Anwendungsbeschreibung: Biological Origin: Smallpox virus. Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length