A27L protein

Catalog Number: BYT-ORB383445
Article Name: A27L protein
Biozol Catalog Number: BYT-ORB383445
Supplier Catalog Number: orb383445
Alternative Catalog Number: BYT-ORB383445-20,BYT-ORB383445-100,BYT-ORB383445-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: A27L, A30L14 kDa fusion protein
Recombinant A27L protein
Molecular Weight: 15.0 kDa
UniProt: P33816
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Smallpox virus
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Application Notes: Biological Origin: Smallpox virus. Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length