Human GLP1R protein

Artikelnummer: BYT-ORB383448
Artikelname: Human GLP1R protein
Artikelnummer: BYT-ORB383448
Hersteller Artikelnummer: orb383448
Alternativnummer: BYT-ORB383448-20,BYT-ORB383448-100,BYT-ORB383448-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GLP-1 receptor Short name, GLP-1-R Short name, GLP-1R
Recombinant human GLP1R protein
Molekulargewicht: 18.3 kDa
UniProt: P43220
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial