Human GLP1R protein

Catalog Number: BYT-ORB383448
Article Name: Human GLP1R protein
Biozol Catalog Number: BYT-ORB383448
Supplier Catalog Number: orb383448
Alternative Catalog Number: BYT-ORB383448-20,BYT-ORB383448-100,BYT-ORB383448-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GLP-1 receptor Short name, GLP-1-R Short name, GLP-1R
Recombinant human GLP1R protein
Molecular Weight: 18.3 kDa
UniProt: P43220
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial