Animal TES-26 protein

Artikelnummer: BYT-ORB383451
Artikelname: Animal TES-26 protein
Artikelnummer: BYT-ORB383451
Hersteller Artikelnummer: orb383451
Alternativnummer: BYT-ORB383451-20,BYT-ORB383451-100,BYT-ORB383451-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Toxocara excretory-secretory antigen 26 Short name, TES-26
Recombinant animal TES-26 protein
Molekulargewicht: 27.9 kDa
UniProt: P54190
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Toxocara canis (Canine roundworm)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Anwendungsbeschreibung: Biological Origin: Toxocara canis (Canine roundworm). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial