Animal TES-26 protein

Catalog Number: BYT-ORB383451
Article Name: Animal TES-26 protein
Biozol Catalog Number: BYT-ORB383451
Supplier Catalog Number: orb383451
Alternative Catalog Number: BYT-ORB383451-20,BYT-ORB383451-100,BYT-ORB383451-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Toxocara excretory-secretory antigen 26 Short name, TES-26
Recombinant animal TES-26 protein
Molecular Weight: 27.9 kDa
UniProt: P54190
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Toxocara canis (Canine roundworm)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Application Notes: Biological Origin: Toxocara canis (Canine roundworm). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial