G protein

Produktübersicht

• Artikelname: G protein
• Artikelnummer: BYT-ORB383459
• Hersteller Artikelnummer: orb383459
• Alternativnummer: BYT-ORB383459-1,BYT-ORB383459-100,BYT-ORB383459-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: GGlycoprotein

Produktbeschreibung

This G protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 51.5 kDa
• UniProt: P19462
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rabies virus (strain HEP-Flury) (RABV)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KFPIYTIPDKLGPWSPIDLHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVTDLDPYDKSLHSRVFPGGNCSGITVSSTYCSTNHDYTIWMPENLRLGTSCDIFTHSRGKRASKGDKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Rabies virus (strain HEP-Flury) (RABV). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Rabies virus (strain HEP-Flury) (RABV) G.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Rabies virus (strain HEP-Flury) (RABV) G.