G protein
Catalog Number:
BYT-ORB383459
- Images (3)
| Article Name: | G protein |
| Biozol Catalog Number: | BYT-ORB383459 |
| Supplier Catalog Number: | orb383459 |
| Alternative Catalog Number: | BYT-ORB383459-1,BYT-ORB383459-100,BYT-ORB383459-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | GGlycoprotein |
| This G protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 51.5 kDa |
| UniProt: | P19462 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Rabies virus (strain HEP-Flury) (RABV) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | KFPIYTIPDKLGPWSPIDLHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVTDLDPYDKSLHSRVFPGGNCSGITVSSTYCSTNHDYTIWMPENLRLGTSCDIFTHSRGKRASKGDKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPG |
| Application Notes: | Biological Origin: Rabies virus (strain HEP-Flury) (RABV). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Rabies virus (strain HEP-Flury) (RABV) G. |
|
|
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Rabies virus (strain HEP-Flury) (RABV) G. |
Product Guarantee and Expert Support
