Mouse ADH2 protein

Produktübersicht

• Artikelname: Mouse ADH2 protein
• Artikelnummer: BYT-ORB418826
• Hersteller Artikelnummer: orb418826
• Alternativnummer: BYT-ORB418826-20,BYT-ORB418826-100,BYT-ORB418826-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Alcohol dehydrogenase class-III Glutathione-dependent formaldehyde dehydrogenase Short name, FALDH Short name, FDH Short name, GSH-FDH S-(hydroxymethyl)glutathione dehydrogenase

Produktbeschreibung

This Mouse ADH2 protein spans the amino acid sequence from region 2-379aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 56.6 kDa
• UniProt: Q96533
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Arabidopsis thaliana (Mouse-ear cress)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ATQGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQAGDHVIPCYQAECRECKFCKSGKTNLCGKVRSATGVGIMMNDRKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKIDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKFGVNEFVNPKDHDKPIQEV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-379aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.