Mouse ADH2 protein

Catalog Number: BYT-ORB418826
Article Name: Mouse ADH2 protein
Biozol Catalog Number: BYT-ORB418826
Supplier Catalog Number: orb418826
Alternative Catalog Number: BYT-ORB418826-20,BYT-ORB418826-100,BYT-ORB418826-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Alcohol dehydrogenase class-III Glutathione-dependent formaldehyde dehydrogenase Short name, FALDH Short name, FDH Short name, GSH-FDH S-(hydroxymethyl)glutathione dehydrogenase
This Mouse ADH2 protein spans the amino acid sequence from region 2-379aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56.6 kDa
UniProt: Q96533
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATQGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQAGDHVIPCYQAECRECKFCKSGKTNLCGKVRSATGVGIMMNDRKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKIDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKFGVNEFVNPKDHDKPIQEV
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-379aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.