Mouse BAS1 protein

Artikelnummer: BYT-ORB418829
Artikelname: Mouse BAS1 protein
Artikelnummer: BYT-ORB418829
Hersteller Artikelnummer: orb418829
Alternativnummer: BYT-ORB418829-20,BYT-ORB418829-100,BYT-ORB418829-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Thiol-specific antioxidant protein A
This Mouse BAS1 protein spans the amino acid sequence from region 66-266aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.4 kDa
UniProt: Q96291
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Arabidopsis thaliana (Mouse-ear cress)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 66-266aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.