Mouse BAS1 protein

Catalog Number: BYT-ORB418829
Article Name: Mouse BAS1 protein
Biozol Catalog Number: BYT-ORB418829
Supplier Catalog Number: orb418829
Alternative Catalog Number: BYT-ORB418829-20,BYT-ORB418829-100,BYT-ORB418829-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Thiol-specific antioxidant protein A
This Mouse BAS1 protein spans the amino acid sequence from region 66-266aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.4 kDa
UniProt: Q96291
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 66-266aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.