E. coli GHRA protein

Artikelnummer: BYT-ORB418883
Artikelname: E. coli GHRA protein
Artikelnummer: BYT-ORB418883
Hersteller Artikelnummer: orb418883
Alternativnummer: BYT-ORB418883-20,BYT-ORB418883-100,BYT-ORB418883-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 2-ketoacid reductase
This E. coli GHRA protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 35.4 kDa
UniProt: B7LFE3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain 55989 / EAEC)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNR
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain 55989 / EAEC). Application Notes: Tag Info: NO-taggedExpression Region: 1-312aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.