E. coli GHRA protein

Catalog Number: BYT-ORB418883
Article Name: E. coli GHRA protein
Biozol Catalog Number: BYT-ORB418883
Supplier Catalog Number: orb418883
Alternative Catalog Number: BYT-ORB418883-20,BYT-ORB418883-100,BYT-ORB418883-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 2-ketoacid reductase
This E. coli GHRA protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 35.4 kDa
UniProt: B7LFE3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain 55989 / EAEC)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNR
Application Notes: Biological Origin: Escherichia coli (strain 55989 / EAEC). Application Notes: Tag Info: NO-taggedExpression Region: 1-312aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.