E. coli FANC protein

Produktübersicht

• Artikelname: E. coli FANC protein
• Artikelnummer: BYT-ORB418884
• Hersteller Artikelnummer: orb418884
• Alternativnummer: BYT-ORB418884-20,BYT-ORB418884-100,BYT-ORB418884-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: fanCK99 fimbrial protein

Produktbeschreibung

This E. coli FANC protein spans the amino acid sequence from region 23-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 16.5 kDa
• UniProt: P18103
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia coli
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia coli. Application Notes: Tag Info: NO-taggedExpression Region: 23-181aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colifanC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colifanC.