E. coli FANC protein

Product Overview

• Article Name: E. coli FANC protein
• Biozol Catalog Number: BYT-ORB418884
• Supplier Catalog Number: orb418884
• Alternative Catalog Number: BYT-ORB418884-20,BYT-ORB418884-100,BYT-ORB418884-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: fanCK99 fimbrial protein

Product Description

This E. coli FANC protein spans the amino acid sequence from region 23-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 16.5 kDa
• UniProt: P18103
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM

Application Notes

• Application Notes: Biological Origin: Escherichia coli. Application Notes: Tag Info: NO-taggedExpression Region: 23-181aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colifanC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colifanC.