E. coli FANC protein

Catalog Number: BYT-ORB418884
Article Name: E. coli FANC protein
Biozol Catalog Number: BYT-ORB418884
Supplier Catalog Number: orb418884
Alternative Catalog Number: BYT-ORB418884-20,BYT-ORB418884-100,BYT-ORB418884-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: fanCK99 fimbrial protein
This E. coli FANC protein spans the amino acid sequence from region 23-181aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 16.5 kDa
UniProt: P18103
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Application Notes: Biological Origin: Escherichia coli. Application Notes: Tag Info: NO-taggedExpression Region: 23-181aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colifanC.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colifanC.