Mouse DCT protein

Produktübersicht

• Artikelname: Mouse DCT protein
• Artikelnummer: BYT-ORB418893
• Hersteller Artikelnummer: orb418893
• Alternativnummer: BYT-ORB418893-1,BYT-ORB418893-100,BYT-ORB418893-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: DOPAchrome conversion factor1 DOPAchrome isomerase1 DOPAchrome oxidoreductase1 L-dopachrome Delta-isomerase SLATY locus protein Tyrosinase-related protein 2

Produktbeschreibung

This Mouse DCT protein spans the amino acid sequence from region 24-472aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 69.7 kDa
• UniProt: P29812
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QFPRVCMTLDGVLNKECCPPLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNRKKPAILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFSHQGPAFVTWHRYHLLWLERELQRLTGNESFALPYWNFATGKNECDVCTDELLGAARQDDPTLISRNSR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-SUMO-taggedExpression Region: 24-472aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.