Mouse DCT protein

Catalog Number: BYT-ORB418893
Article Name: Mouse DCT protein
Biozol Catalog Number: BYT-ORB418893
Supplier Catalog Number: orb418893
Alternative Catalog Number: BYT-ORB418893-1,BYT-ORB418893-100,BYT-ORB418893-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DOPAchrome conversion factor1 DOPAchrome isomerase1 DOPAchrome oxidoreductase1 L-dopachrome Delta-isomerase SLATY locus protein Tyrosinase-related protein 2
This Mouse DCT protein spans the amino acid sequence from region 24-472aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 69.7 kDa
UniProt: P29812
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QFPRVCMTLDGVLNKECCPPLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNRKKPAILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFSHQGPAFVTWHRYHLLWLERELQRLTGNESFALPYWNFATGKNECDVCTDELLGAARQDDPTLISRNSR
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-SUMO-taggedExpression Region: 24-472aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.